Dataset for protein Bcl2l10 of organism Propithecus coquereli

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A2K6F2Q2_BCL2L10-01 BCL2-like 10 protein OS=[Eukaryota] Propithecus coquereli GN=BCL2L10 (length=192 residues).
MGDRFRERTERLLADYLEYCTREPGAPGLPPSSLEAAAMRFAATKIRRKHASFFSAYVGYPGNRVYLLERMAEAVLCDSL
SWGRVVMLVTFAGTLLERGPPVTAWWKKWGLQPQPKEGDPEVARDRQRLVALLCARLAGQHRAWLQAQGGWDGFCDLFRK
PLPLAVWRRLLVQVLLSCFLATTVIYFWTRLL
© 1998-2019