Dataset for protein Bcl-2 of organism Pongo abelii

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|H2NWH5_BCL2-01 B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Pongo abelii GN=BCL-2 (length=238 residues).
MAHAGTTGYDNREIVDEXIHYKLSQRGYEWDAGDVGAAPPGAATAPGIFSSQPGHTPHPAASRDPARTSPLPTPAAPGAA
VGPALSPVPPVVHLTLRQAGDDFSRRYRRDFAEMSSQLHLTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVES
VNREMSPLVDNIALWMTEYLNRHLHTWIQDNGGWDAFVELYGPSMRPLFDFSWLSLKTLLSLALVGACITLGAYLGHK
© 1998-2019