Dataset for protein BCL-2-like of organism Poecilia reticulata

[Download (right click)] [Alignment] [Repertoires]

5 sequence(s)

>gnl|bcl2dbpro|A0A3P9N9Y4_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Poecilia reticulata GN=BCL2L1 (length=231 residues).
MSRNRELVLFYIKFKLSQRNYPIQHILPNEPPDSTAARDAAGDGGMDDEQTLETHANGTFNGTSPGSPRRQQAASASTMD
AVKVTLRDTAREFELRYSRAFNDLHSTLHITPATAYQSFENVMDEVFRDGVNWGRIVGLFAFGGALCVECVEKEMSHLVA
RIVEWMTVYLDERIEPWVESQGGWERFAEIFGGNAAAESRRSQESFKNWLLLGMSVVTAFIAGSIFAQKRL
>gnl|bcl2dbpro|A0A3P9NE65_BCL2L10-01 BCL2-like 10 protein OS=[Eukaryota] Poecilia reticulata GN=BCL2L10 (length=216 residues).
MRRGSPSAVWMCREPSHIAGRKMSCGLWKETVAVAEDYIHLRCSNPHPAPPPPSEPAAAMRRLAQDVEAQHQARFHSLAQ
GFLKHCGTDLCSNLRKVMDEMVGDGHFNWGRVVSLFAFAGVLARQLREQTGKNPGPDSGKQQELQQETVSCRALAETIAD
YLEKHKKDWLQENNGWDGFCSYALNAREVSQDSSMKTALVAVAGVGIAGLTFLLVR
>gnl|bcl2dbpro|A0A3P9Q4R7_MCL1-02 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Poecilia reticulata GN=MCL-1 (length=276 residues).
MTANSTTALNYLIFSQNGVGNGQTHYDQGLVVPEVAMGSRVESLHSPMDPFKKRPTNLAVTASNGYVAKSLPESSDDSDE
GSLPCTPAQQDGETDASAVRASNQVLDNDTTELISSFLRNFTGLSKCRWSQNKALSTMKRVVEDVLSKHRYAYNGMLSKL
ALDNQPDNMGFVTEVAESLFSDGTTNWGRIVSLVAFGAVVCQHLKERGREHCVDLVSQEISTYLLAKQRDWLAKNNSWEG
FVEFFRVSDPESTVRNTLMAFVGVAGIGATLAFLIR
>gnl|bcl2dbpro|A0A3P9Q4R7_MCL1-01 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Poecilia reticulata GN=MCL-1 (length=277 residues).
MTANSTTALNYLIFSQNGVGNGQTHYDQGLVVPEVAMGSRVESLHSPMDPFKKRPTNLAVTASNGYVAKSLPESSDDSDE
GSLPCTPAQQDGETDASAVRASNQVLDNDTTELISSFLRNFTGLSKCRWSQNKALSTMKRVVEDVLSKHRYAYNGMLSKL
ALDNQPDNMGFVTEVAESLFSDGTTNWGRIVSLVAFGAVVCQHLKERGREHCVDLVSQEISTYLLAKQRDWLAKNNSWEG
FVEFFRVSDPESTVRNTLMAFVGVAGIGATLAFLISK
>gnl|bcl2dbpro|A0A3P9QFB3_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Poecilia reticulata GN=BCL2L1 (length=217 residues).
MSYSNRELVEFYISYKLSQRNYSSSLLRSEADGARTNWDGDSRGPSNGPLVNSRAGSRGKSQGPPVEVVKSVLKDAAEEF
ERLYTQSFKHLSLQLDITPDTAYHSFKTVLDELFKGEVNWGRVVAMFTFGGILCVDCVQKNMSELVSRIAEWMTTYLDEQ
LNPWIQSQGGWDHFANLYGQDAAAEGRRFRETLNKWLLVGVALLTGALLVMFIAKKR
© 1998-2019