Dataset for protein Bcl-xL of organism Poecilia reticulata

[Download (right click)] [Alignment] [Repertoires]

2 sequence(s)

>gnl|bcl2dbpro|A0A3P9N9Y4_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Poecilia reticulata GN=BCL2L1 (length=231 residues).
MSRNRELVLFYIKFKLSQRNYPIQHILPNEPPDSTAARDAAGDGGMDDEQTLETHANGTFNGTSPGSPRRQQAASASTMD
AVKVTLRDTAREFELRYSRAFNDLHSTLHITPATAYQSFENVMDEVFRDGVNWGRIVGLFAFGGALCVECVEKEMSHLVA
RIVEWMTVYLDERIEPWVESQGGWERFAEIFGGNAAAESRRSQESFKNWLLLGMSVVTAFIAGSIFAQKRL
>gnl|bcl2dbpro|A0A3P9QFB3_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Poecilia reticulata GN=BCL2L1 (length=217 residues).
MSYSNRELVEFYISYKLSQRNYSSSLLRSEADGARTNWDGDSRGPSNGPLVNSRAGSRGKSQGPPVEVVKSVLKDAAEEF
ERLYTQSFKHLSLQLDITPDTAYHSFKTVLDELFKGEVNWGRVVAMFTFGGILCVDCVQKNMSELVSRIAEWMTTYLDEQ
LNPWIQSQGGWDHFANLYGQDAAAEGRRFRETLNKWLLVGVALLTGALLVMFIAKKR
© 1998-2019