Dataset for protein Bcl-xL of organism Poecilia mexicana

[Download (right click)] [Alignment] [Repertoires]

2 sequence(s)

>gnl|bcl2dbpro|A0A3B3WI27_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Poecilia mexicana GN=BCL2L1 (length=231 residues).
MSRNRELVLFYIKFKLSQRNYPIQHILPNEPPDSTAAGDAAGDAGMDDEQTLETHANGTFNGTSPGSPRRQQAASAATMD
AVKVTLRDTAREFELRYSRAFNDLHSTLHITPATAYQSFENVMDEVFRDGVNWGRIVGLFAFGGALCVECVEKEMSHLVA
RIVEWMTVYLDERIEPWVESQGGWDRFAEIFGGNAAAESRRSQESFKNWLLLGMSVVTAFIAGSIFAQKRL
>gnl|bcl2dbpro|A0A3B3XN57_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Poecilia mexicana GN=BCL2L1 (length=219 residues).
MSYSNRELVEFYISYKLSQRNYSSSLLRSEADGARTNWDGDSRGPSNGPLVNSWAGSPGKSQDPPTGVEVVKSVLKDAAE
EFERLYTQSFKHLSLQLDITPDTAYQSFKTVLDELFKGEVNWGRVVAMFTFGGILCVDCVQKNMSELVSRIAEWMTTYLD
EQLNPWIQSQGGWDRFANLYGQDAAAEGRRFRETLNKWLLVGVALLTGALLVMFVAKKR
© 1998-2019