Dataset for protein Unclassified of organism Poecilia formosa

[Download (right click)]

2 sequence(s)

>gnl|bcl2dbpro|A0A087YSS6_uncBCL2-02 Putative B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Poecilia formosa (length=195 residues).
MANDYNRNIVENYICHKLSKRGYVWGFNGVPDDDAANNGGLGDHSPTLVRRCRDAGPGPDSDSDPHRLCRRISQSDPYAD
IHRVLRDAGDELEKLYQLDFVEMSQQLYLTRDTARTRFAEVINELFRDGVNWGRIIAFFEFGSTVCVECASKEEMTSQVD
NIAEWMTEYLNGPLDSWIQDNGGWPLKRFADLLQR
>gnl|bcl2dbpro|A0A087YSS6_uncBCL2-01 Putative B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Poecilia formosa (length=229 residues).
MANDYNRNIVENYICHKLSKRGYVWGFNGVPDDDAANNGGLGDHSPTLVRRCRDAGPGPDSDSDPHRLCRRISQSDPYAD
IHRVLRDAGDELEKLYQLDFVEMSQQLYLTRDTARTRFAEVINELFRDGVNWGRIIAFFEFGSTVCVECASKEEMTSQVD
NIAEWMTEYLNGPLDSWIQDNGGWDAFVELYDRQKESVFSCYWPSIKTVFGLAALGAASVTIGAYLAQK
© 1998-2019