Dataset for protein BCL-2-like of organism Poecilia formosa

[Download (right click)] [Alignment] [Repertoires]

4 sequence(s)

>gnl|bcl2dbpro|A0A087X830_MCL1-01 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Poecilia formosa GN=MCL-1 (length=276 residues).
MTANSTTALNYLIFSQNGVGDGQTHYDQGLVVPEVAMGATVDSLHSPKDPYKKRPTNLAVSASNGYVAKSLQKSSDDSDE
GSLPCTPAQQDSETDASAVRASNQVLDNDTMELISSFLRNFTGLSKCRWSQNKALSTMKRVVEDVLSKHRYAYNGMLNRL
ALDNQPDNMGFVTEVAENLFSDGTTNWGRIVSLVAFGAAVCQHLKERGREHCVELVSKEISTYLLENQRDWLAKNNSWEG
FVEFFRVSDPESTVRNTLMAFVGVAGIGATLAFLIR
>gnl|bcl2dbpro|A0A087X9B7_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Poecilia formosa GN=BCL2L1 (length=231 residues).
MSRNRELVLFYIKFKLSQRNYPIQHILPNEPPDSTAAGDAAGDAGMDDEQTLETHANGTFNGTSPGSPRRQQAASAATMD
AVKVTLRDTAREFELRYSRAFNDLHSTLHITPATAYQSFENVMDEVFRDGVNWGRIVGLFAFGGALCVECVEKEMSHLVA
RIVEWMTVYLDERIEPWVESQGGWDRFAEIFGGNAAAESRRSQESFKNWLLLGMSVVTAFIAGSIFAQKRL
>gnl|bcl2dbpro|A0A087YBW4_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Poecilia formosa GN=BCL2L1 (length=219 residues).
MSYSNRELVEFYISYKLSQRNYSSSLLRSEADGARTNWDGDSRGPSNGPLVNSWAGSPGKSRDPPTGVKVVKLVLKDAAE
EFERLYTQSFKHLSLQLDITPDTAYQSFKTVLDELFKGEVNWGRVVAMFTFGGILCVDCVQKNMSELVSRIAEWMTTYLD
EQLNPWIQSQGGWDRFANLYGQDAAAEGRRFRETLNKWLLVGVALLTGALLVMFVAKKR
>gnl|bcl2dbpro|A0A096ME02_BCL2L10-01 BCL2-like 10 protein OS=[Eukaryota] Poecilia formosa GN=BCL2L10 (length=216 residues).
MHRGSPSAVWMCREPSHIAGRKMSCGLWKETVAVAEDYIHLRCSSPHPAPPPPSEPAAAMRRLAQDVEAQHQARFHSLAQ
GFLKHCGTDLCSNLRKVMDEMVGDGHFNWGRVVSLFAFAGVLARQLREQTGKNPGPDSGKQQELQQEPVSCRALAETIAD
YLEKHKKDWLQENNGWDGFCSYAHNAREVSQDSSMKTALVAVAGVGIAGLTFLLVR
© 1998-2019