Dataset for protein Unclassified of organism Petromyzon marinus

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|S4RB20_uncBCL2L1-01 Putative BCL2-like 1 protein OS=[Eukaryota] Petromyzon marinus (length=145 residues).
VQRAMRASGDEFERRYRSAFAQLPAQLQVSQATLRARFSDVLDELFRDGVNWGRVVAFFAFGGALCAECVDKELPGLVSS
VATWMTSYLEDRLLWWIDDNGGWKALIYVAPTHLYFFSFVWSSLCLKNVKLHGYCNSLMNLLPAA
© 1998-2019