Dataset for protein Unclassified of organism Perna viridis

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A346RRN2_uncBCL2L1-01 Putative BCL2-like 1 protein OS=[Eukaryota] Perna viridis (length=184 residues).
MDPTGTRYLVVDYVNYRLNNNGVQWGQCPSLLPQPLEVHLTLRDKGNELEARYKAVFQRRIDDLHITENTAYPVFRTVVD
EIFNGGINWGRIVALFSFGGSLATACMKKDLPQLIDSIIEWITIYIDENLSAWIQSHGGWQGFVEYYNQAQNHNDNQWNL
GEFVRYGAIGVVGALALGALLQRV
© 1998-2019