Dataset for protein Unclassified of organism Periophthalmus magnuspinnatus

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A3B4B2U1_uncMCL1-01 Putative Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Periophthalmus magnuspinnatus (length=192 residues).
MGGRSNPSRDEGGRTRLRSDAQWVLKQWCTALDAKRTMFDKVLRGVLEDMVDELVAGEYDFDKAADEVININTLLLEDVI
VVTFVAESVFEDGVVNWGRIIAMMVFGAALGRKLQTAGQEHAMEKVVNELVVFFWKNYFSGAVQDRREIIGKVTAVLRRY
KVVPPLSTRVKVAVVACLGSLGMALGLRRWFR
© 1998-2019