Dataset for protein BCL-2-like of organism Periophthalmus magnuspinnatus

[Download (right click)] [Alignment] [Repertoires]

7 sequence(s)

>gnl|bcl2dbpro|A0A3B3ZN55_BCL2L1-02 BCL2-like 1 protein OS=[Eukaryota] Periophthalmus magnuspinnatus GN=BCL2L1 (length=214 residues).
MSLNRELVEFYIQYKLSQRDCPLGLEDGTEIDTERDRDLLGLGDRSVDRNSTPSLRLRLDSASDSAPALRDSANEFELRF
SRAFSDLHRQLHITPATAYQSFESVMDEVFRDGVNWGRVVGLFAFGGALAVECVDKEMSTLVARIVTWMTVYLDEHIQDW
IDSQGGWARFAEIYGQDAAAQSRHSEERFKKWLFAGMTLVTGVVVGSLLAQRRL
>gnl|bcl2dbpro|A0A3B3ZN55_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Periophthalmus magnuspinnatus GN=BCL2L1 (length=235 residues).
MSLNRELVEFYIQYKLSQRDCPLQHLGLGDRSTQSDTEHLGLGDRGVDRARLQRETEVDSTELRLDSASDSAPVHSPAPL
LDLDAVKEALRDSANEFELRFSRAFSDLHRQLHITPATAYQSFESVMDEVFRDGVNWGRVVGLFAFGGALAVECVDKEMS
TLVARIVTWMTVYLDEHIQDWIDSQGGWARFAEIYGQDAAAQSRHSEERFKKWLFAGMTLVTGVVVGSLLAQRRL
>gnl|bcl2dbpro|A0A3B4A3G8_BCL2-01 B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Periophthalmus magnuspinnatus GN=BCL-2 (length=219 residues).
MANDCNRNIVEKYICHKLSKRGFAWGFHEDAEDEGDVANNGSIVASSPVLVNRRCRAERLCSAPSDPHAAIHRVLREAGD
ELERLYQPDFTEMSRQLYLTSSTAQRRFAEVIDELFRDGVNWGRIIAFFEFGGTVCVECASKEDMSSQVDNIADWMTEYL
NGTLSSWIQDNGGWEAFVELYDRQRDSVFSCSWPSIKTVFGLAAIGAASLTIGAYLSQK
>gnl|bcl2dbpro|A0A3B4AAV4_BCL2L10-01 BCL2-like 10 protein OS=[Eukaryota] Periophthalmus magnuspinnatus GN=BCL2L10 (length=194 residues).
MSCGLWKETLALAEDYLSLCCSGPQAAPPPPSGSASAMRRLGQDMEAQHKARFHSLSQTFLKQCGPDPCSSLRKVMEELV
GDGHLNWGRVVSLFTFAGVLARHIKEQKSSRPGLDPGQVQGLGQVPSDCRRLAQTIADYLGEEKRDWLLENGGWVGFCEF
SCHARKVDQDSSMKTALFAAAGVGLAGLTFLLVR
>gnl|bcl2dbpro|A0A3B4AFB7_MCL1-01 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Periophthalmus magnuspinnatus GN=MCL-1 (length=246 residues).
DTTCLQGVLTPPLGTAHICGSPHPRPTALVMKNELLNKNTREEDYENSEGSLPCTPEFHSDSEMELSSYSAEHEVLESDT
RQLLSDFFKLFTGISQPKWKQRPALSTMKGVVDKLLEKHRYAYNGMINKLALDDRGDDVSFIGTVAKSIFEDGTTNWGRI
ASLIAFGAVVCQYLKTKGRESCVERVGQEISSYLLLDQRDWLVRNNAWDGFVDFFRVEDPESAVRNTLMAVAGLAGIGAT
LAMLIR
>gnl|bcl2dbpro|A0A3B4AFB7_MCL1-02 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Periophthalmus magnuspinnatus GN=MCL-1 (length=285 residues).
MNIINSPKRTALKLSTMGLFLPQNGLAEGDMHCGAADSSAQMPRPATMDTRKGNTASSGSPHPRPTALVMKNELLNKNTR
EEDYENSEGSLPCTPEFHSDSEMELSSYSAEHEVLESDTRQLLSDFFKLFTGISQPKWKQRPALSTMKGVVDKLLEKHRY
AYNGMINKLALDDRGDDVSFIGTVAKSIFEDGTTNWGRIASLIAFGAVVCQYLKTKGRESCVERVGQEISSYLLLDQRDW
LVRNNAWDGFVDFFRVEDPESAVRNTLMAVAGLAGIGATLAMLIR
>gnl|bcl2dbpro|A0A3B4BFZ8_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Periophthalmus magnuspinnatus GN=BCL2L1 (length=218 residues).
MSPSNRELVEFFISYKLSQKNYPSSLLMSDPARVQCEGNKAANVPNGMLTNRNGNRQTLASLPPDDHLDAIKTALTDSAD
EFEELFTQAFSNLSSQLDITPDTAYNSFKSVMDEVFKDGVNWGRIVGLFVFGGVLSVECVEKDMSILVPRIANWMTIYLD
ENIATWIQNQGGWASFAQIFGQNAAGEARRSRETLKKWLLVGVGLLAGVLVAMLIAKK
© 1998-2019