Dataset for protein Bcl-xL of organism Periophthalmus magnuspinnatus

[Download (right click)] [Alignment] [Repertoires]

3 sequence(s)

>gnl|bcl2dbpro|A0A3B3ZN55_BCL2L1-02 BCL2-like 1 protein OS=[Eukaryota] Periophthalmus magnuspinnatus GN=BCL2L1 (length=214 residues).
MSLNRELVEFYIQYKLSQRDCPLGLEDGTEIDTERDRDLLGLGDRSVDRNSTPSLRLRLDSASDSAPALRDSANEFELRF
SRAFSDLHRQLHITPATAYQSFESVMDEVFRDGVNWGRVVGLFAFGGALAVECVDKEMSTLVARIVTWMTVYLDEHIQDW
IDSQGGWARFAEIYGQDAAAQSRHSEERFKKWLFAGMTLVTGVVVGSLLAQRRL
>gnl|bcl2dbpro|A0A3B3ZN55_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Periophthalmus magnuspinnatus GN=BCL2L1 (length=235 residues).
MSLNRELVEFYIQYKLSQRDCPLQHLGLGDRSTQSDTEHLGLGDRGVDRARLQRETEVDSTELRLDSASDSAPVHSPAPL
LDLDAVKEALRDSANEFELRFSRAFSDLHRQLHITPATAYQSFESVMDEVFRDGVNWGRVVGLFAFGGALAVECVDKEMS
TLVARIVTWMTVYLDEHIQDWIDSQGGWARFAEIYGQDAAAQSRHSEERFKKWLFAGMTLVTGVVVGSLLAQRRL
>gnl|bcl2dbpro|A0A3B4BFZ8_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Periophthalmus magnuspinnatus GN=BCL2L1 (length=218 residues).
MSPSNRELVEFFISYKLSQKNYPSSLLMSDPARVQCEGNKAANVPNGMLTNRNGNRQTLASLPPDDHLDAIKTALTDSAD
EFEELFTQAFSNLSSQLDITPDTAYNSFKSVMDEVFKDGVNWGRIVGLFVFGGVLSVECVEKDMSILVPRIANWMTIYLD
ENIATWIQNQGGWASFAQIFGQNAAGEARRSRETLKKWLLVGVGLLAGVLVAMLIAKK
© 1998-2019