Dataset for protein Mcl-1 of organism Pelodiscus sinensis

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|K7FPN7_MCL1-01 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Pelodiscus sinensis GN=MCL-1 (length=121 residues).
GMLRKLDIKNEEDLKSVSSVATHVFSDGITNWGRIVTLISFGAFVAKHLKSINQENCINTLAGIITDVLVSDKRDWLVNQ
RGWEGFVEFFRVEDLEGSIRNVLVAFAGFAGLGASLAYMMR
© 1998-2019