Dataset for protein BCL-2-like of organism Pelodiscus sinensis

[Download (right click)] [Alignment] [Repertoires]

6 sequence(s)

>gnl|bcl2dbpro|K7F5Y4_BCL2-03 B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Pelodiscus sinensis GN=BCL-2 (length=171 residues).
MAHPGRRGYDNREIVLKYIHYKLSQRGYDWAANENRGPVSSSLSPPAAGSAAASNVPLGDGLRSAPQAVHLTLCQAGDEF
SRRYHRDFAQMSGQLHLTPFTARGRFVAVVEELFRDGINWGRIVAFFEFGGVMCVESVNREMSPLVDSIAVWMTEYLNRH
LHNWIQDNGGW
>gnl|bcl2dbpro|K7F5Y4_BCL2-01 B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Pelodiscus sinensis GN=BCL-2 (length=232 residues).
MAHPGRRGYDNREIVLKYIHYKLSQRGYDWAANENRGPVSSSLSPPAAGTPSDHAGLVSLPPEPPGSAAASNVPLGDGLR
SAPQAVHLTLCQAGDEFSRRYHRDFAQMSGQLHLTPFTARGRFVAVVEELFRDGINWGRIVAFFEFGGVMCVESVNREMS
PLVDSIAVWMTEYLNRHLHNWIQDNGGWDAFVELYGSNMRPLFDFSWISLKTILSLALVGACITLGAYLGHK
>gnl|bcl2dbpro|K7F5Y4_BCL2-02 B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Pelodiscus sinensis GN=BCL-2 (length=195 residues).
MAHPGRRGYDNREIVLKYIHYKLSQRGYDWAANENRGPVSSSLSPPAAGTPSDHAGLVSLPPEPPGSAAASNVPLGDGLR
SAPQAVHLTLCQAGDEFSRRYHRDFAQMSGQLHLTPFTARGRFVAVVEELFRDGINWGRIVAFFEFGGVMCVESVNREMS
PLVDSIAVWMTEYLNRHLHNWIQDNGGWAGAVSVL
>gnl|bcl2dbpro|K7F655_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Pelodiscus sinensis GN=BCL2L1 (length=229 residues).
MSNTNRELVIDFLSYKLSQRGHSWSWFEGEDEIRTEAAEEAEMASVPNGSPSWHPGASHVVNGAAGHSNSLEAHERVPAA
EVRQALREAGDEFELRYRRAFSDLTSQLHITLGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQVLVG
RIASWMTTYLTDHLDPWIQENGGWERFVDLYGNDAAAKSRKGQEQFNRGLLTGATVAGVLLLGSLLSRK
>gnl|bcl2dbpro|K7FPN7_MCL1-01 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Pelodiscus sinensis GN=MCL-1 (length=121 residues).
GMLRKLDIKNEEDLKSVSSVATHVFSDGITNWGRIVTLISFGAFVAKHLKSINQENCINTLAGIITDVLVSDKRDWLVNQ
RGWEGFVEFFRVEDLEGSIRNVLVAFAGFAGLGASLAYMMR
>gnl|bcl2dbpro|K7G130_BCL2A1-01 BCL2-related protein A1 protein OS=[Eukaryota] Pelodiscus sinensis GN=BCL2A1 (length=175 residues).
MESSEFRYVYYLVQDYLKYILQEPELGPAPSRVAHVLRNSASFLQKENEEILKPCLDTLDITSVDAARRIFIQVMDKEFD
DGNTNWGRILTIFMFGGILSKRLQEHKVQLTGDNKEQISYFITEYIINTKAEWIDANGGWENGFLPMFEEKQSWLSLFNI
KAKIMDAFSFFSQYY
© 1998-2019