Dataset for protein Bcl-xL of organism Pelodiscus sinensis

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|K7F655_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Pelodiscus sinensis GN=BCL2L1 (length=229 residues).
MSNTNRELVIDFLSYKLSQRGHSWSWFEGEDEIRTEAAEEAEMASVPNGSPSWHPGASHVVNGAAGHSNSLEAHERVPAA
EVRQALREAGDEFELRYRRAFSDLTSQLHITLGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQVLVG
RIASWMTTYLTDHLDPWIQENGGWERFVDLYGNDAAAKSRKGQEQFNRGLLTGATVAGVLLLGSLLSRK
© 1998-2019