Dataset for protein Bfl1 of organism Pelodiscus sinensis

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|K7G130_BCL2A1-01 BCL2-related protein A1 protein OS=[Eukaryota] Pelodiscus sinensis GN=BCL2A1 (length=175 residues).
MESSEFRYVYYLVQDYLKYILQEPELGPAPSRVAHVLRNSASFLQKENEEILKPCLDTLDITSVDAARRIFIQVMDKEFD
DGNTNWGRILTIFMFGGILSKRLQEHKVQLTGDNKEQISYFITEYIINTKAEWIDANGGWENGFLPMFEEKQSWLSLFNI
KAKIMDAFSFFSQYY
© 1998-2019