Dataset for protein Bcl-2 of organism Pelodiscus sinensis

[Download (right click)] [Alignment] [Repertoires]

3 sequence(s)

>gnl|bcl2dbpro|K7F5Y4_BCL2-03 B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Pelodiscus sinensis GN=BCL-2 (length=171 residues).
MAHPGRRGYDNREIVLKYIHYKLSQRGYDWAANENRGPVSSSLSPPAAGSAAASNVPLGDGLRSAPQAVHLTLCQAGDEF
SRRYHRDFAQMSGQLHLTPFTARGRFVAVVEELFRDGINWGRIVAFFEFGGVMCVESVNREMSPLVDSIAVWMTEYLNRH
LHNWIQDNGGW
>gnl|bcl2dbpro|K7F5Y4_BCL2-01 B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Pelodiscus sinensis GN=BCL-2 (length=232 residues).
MAHPGRRGYDNREIVLKYIHYKLSQRGYDWAANENRGPVSSSLSPPAAGTPSDHAGLVSLPPEPPGSAAASNVPLGDGLR
SAPQAVHLTLCQAGDEFSRRYHRDFAQMSGQLHLTPFTARGRFVAVVEELFRDGINWGRIVAFFEFGGVMCVESVNREMS
PLVDSIAVWMTEYLNRHLHNWIQDNGGWDAFVELYGSNMRPLFDFSWISLKTILSLALVGACITLGAYLGHK
>gnl|bcl2dbpro|K7F5Y4_BCL2-02 B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Pelodiscus sinensis GN=BCL-2 (length=195 residues).
MAHPGRRGYDNREIVLKYIHYKLSQRGYDWAANENRGPVSSSLSPPAAGTPSDHAGLVSLPPEPPGSAAASNVPLGDGLR
SAPQAVHLTLCQAGDEFSRRYHRDFAQMSGQLHLTPFTARGRFVAVVEELFRDGINWGRIVAFFEFGGVMCVESVNREMS
PLVDSIAVWMTEYLNRHLHNWIQDNGGWAGAVSVL
© 1998-2019