Dataset for protein Unclassified of organism Paramormyrops kingsleyae

[Download (right click)]

9 sequence(s)

>gnl|bcl2dbpro|A0A3B3Q8Q8_uncBCL2A1-02 Putative BCL2-related protein A1 protein OS=[Eukaryota] Paramormyrops kingsleyae (length=245 residues).
MGMLKFACAAGVMAAAAGTAYLYRRFRKTPEQEEVNMATSLRDETLMVANDYMDFCIGIKRTPPSESAKAMRYMAKEVEK
EYEFRLRRLVRFFFITSGFNTWTELKNVMLEMVGHESMSWSQIVTLFAFTGILAVQLSNVDEDVACSRRLAEMITDVLLG
EKEEWIIQNGGWRGFVDYVHTAKPGYPDSPVKRALLAAANVTIAFLLVRYSISFPCYSEKCFPERFLIKFFLIYVHMVHC
CFPHD
>gnl|bcl2dbpro|A0A3B3Q8Q8_uncBCL2A1-01 Putative BCL2-related protein A1 protein OS=[Eukaryota] Paramormyrops kingsleyae (length=201 residues).
MGMLKFACAAGVMAAAAGTAYLYRRFRKTPEQEEVNMATSLRDETLMVANDYMDFCIGIKRTPPSESAKAMRYMAKEVEK
EYEFRLRRLVRFFFITSGFNTWTELKNVMLEMVGHESMSWSQIVTLFAFTGILAVQLSNVDEDVACSRRLAEMITDVLLG
EKEEWIIQNGGWISYLLKRTLPGLVPSAMVIFKKLPGTSIS
>gnl|bcl2dbpro|A0A3B3QFC9_uncMCL1-03 Putative Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Paramormyrops kingsleyae (length=189 residues).
MESCEFLSRFWEGKMSCWLSKETLVLAEDYLEFCVGVQRTPPGPASEAMRCLAKEIEKQNLSKFHSLVQTFLDSCGPDRS
SSLRKVMAEMVGDGKLNWGRVVSLFAFTGVLVGELHSRGEGKDCCRRLAETIADYLGVEKQDWLLQNEGWDGFCKFFHSS
RGQNHESAMKTALFAAAGIDRMKTRLCVW
>gnl|bcl2dbpro|A0A3B3QFC9_uncMCL1-01 Putative Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Paramormyrops kingsleyae (length=216 residues).
MESCEFLSRFWEGKMSCWLSKETLVLAEDYLEFCVGVQRTPPGPASEAMRCLAKEIEKQNLSKFHSLVQTFLDSCGPDRS
SSLRKVMAEMVGDGKLNWGRVVSLFAFTGVLVGELHSRGEGKDCCRRLAETIADYLGVEKQDWLLQNEGWDGFCKFFHSS
RGQNHESAMKTALFAAAGDYPLSAVGEPQHRCSLASGHGGSSSGMLRIAADSHVIK
>gnl|bcl2dbpro|A0A3B3QFC9_uncMCL1-02 Putative Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Paramormyrops kingsleyae (length=272 residues).
MESCEFLSRFWEGKMSCWLSKETLVLAEDYLEFCVGVQRTPPGPASEAMRCLAKEIEKQNLSKFHSLVQTFLDSCGPDRS
SSLRKVMAEMVGDGKLNWGRVVSLFAFTGVLVGELHSRGEGKDCCRRLAETIADYLGVEKQDWLLQNEGWDGFCKFFHSS
RGQNHESAMKTALFAAAGSENIRRILFHPLQVPSSGSACLRAPLPKQPFKIMTHVLCLEPERRVLSGLQGFEGMVISDAS
AVARGTAQIKSHTRITVSSRGTRAYYFNPNKF
>gnl|bcl2dbpro|A0A3B3RFU8_uncBCL2-01 Putative B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Paramormyrops kingsleyae (length=219 residues).
MANQSTFDSRIIVENYIHQKLSNRGIDWGMDFGEETEPPANGSTDTALSRRLQTGAAAAPIRSQTTQSDPHAALHAVLRE
AGDQVERRYRRDLVEMSARLHLTPDTTESKFAAVIEELFRDGTNWGRIVAFFEFGVAVCVESVNREMTSQVDHIANWMTE
YLNGPLHTWIQENGGWEAFMELYGRRRGSSEVWPHLKAVVGLVALGVVGVPIAAYMMLK
>gnl|bcl2dbpro|A0A3B3RKL3_uncMCL1-01 Putative Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Paramormyrops kingsleyae (length=297 residues).
MDVTNVKFFLVINSSIMSLLLCCKIWNGCVRIQGLYFVKDVVYEGVAFILFFVVFLTVVENPKHSNVSCSLFAVNIATSL
QEETLMVANDYMDFCIGIKRTPPSESAKAMRYLAKDVESIYGFRLRPLVQLFLVSSGFDTWTKLRNMMLEVIGGEMMSWG
QIVSLFAFMGILAVQLSTGEEDVTCSRRLAEMMTDVLIGEKQEWMIQNGGWRGFVDYVHTVRPGYPESPGKTALLTAANV
AIAGIASSKRSSCVSRPLITSCRNPDCCHLFPIPFALSLVFSPSLSQSCQIRHCDVM
>gnl|bcl2dbpro|A0A3B3S872_uncBCL2A1-01 Putative BCL2-related protein A1 protein OS=[Eukaryota] Paramormyrops kingsleyae (length=191 residues).
MATSLHDETLMVANDYMDLCVGIERTPPSESAKAMRYIAKKVEDMYWLPLRRLVQSFLSNFPIHTWTELRNVMLDMVDRE
NMRWSQIVILFAFTGMLAVQMSTIDEDFTCCRRLADMITDVLRETQEWMIQNGGWRGFVDYVRIFRPEYPVSPVMRGLFT
AANVAIAFLLINYLLKRSLPGLVPFKKLPET
>gnl|bcl2dbpro|A0A3B3S872_uncBCL2A1-02 Putative BCL2-related protein A1 protein OS=[Eukaryota] Paramormyrops kingsleyae (length=227 residues).
MGIMKFACAAGVVAAAAGTAYLYRRFRKTPEQEEVNMATSLHDETLMVANDYMDLCVGIERTPPSESAKAMRYIAKKVED
MYWLPLRRLVQSFLSNFPIHTWTELRNVMLDMVDRENMRWSQIVILFAFTGMLAVQMSTIDEDFTCCRRLADMITDVLRE
TQEWMIQNGGWRGFVDYVRIFRPEYPVSPVMRGLFTAANVAIAFLLINYLLKRSLPGLVPFKKLPET
© 1998-2019