Dataset for protein BCL-2-like of organism Paramormyrops kingsleyae

[Download (right click)] [Alignment] [Repertoires]

5 sequence(s)

>gnl|bcl2dbpro|A0A3B3QRZ2_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Paramormyrops kingsleyae GN=BCL2L1 (length=237 residues).
MSYSNRELVMDFITYKLSQRNYNGHFGLPEDRGRTEGSGQADGREGVMVTATHVNGSVIAGGTSSQVSPVPEQPLHSPSP
SPQGLEAVKEALRDSANEFELRYSRAFSDLSSQLHITPVTAYQSFESVMNEVFRDGINWGRIVGLFAFGGALCVECVEKE
MGHLVDRIADWMTVYLDSNIQPWIQRQGGWDRFAEIFGKDAAAESRRSQENFKKWLLAGMTLITGVVVGSLIAQKRL
>gnl|bcl2dbpro|A0A3B3R4U0_MCL1-01 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Paramormyrops kingsleyae GN=MCL-1 (length=271 residues).
MNLINRTTATGLFCPGIKNGVKQNGFYSFVSASLPVAPLKAKSEEELDSLDEGERFHGAPKTERRDCEHHLRASGNEDGS
LPSTPGTPPDCGKMLTFPNRGLSQETHELIGTFLRTYSGLPASASRHKAYPVLRRVAETVIGKHLIAYNGMIKKLELDKR
GDDTSFVTKVAEEIFSDKVTNWGRIASLIAFGGVVCKYLKDHGQTNCVDDVASRISCYLLEHQRDWLNRNNGWEGFTDFF
YMEDPESTVRNALVAFAGVASLGAGLALLMR
>gnl|bcl2dbpro|A0A3B3SG34_MCL1-01 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Paramormyrops kingsleyae GN=MCL-1 (length=295 residues).
MNPQSLKSYAPIMVSMNYHRPLHHGVLGKSILQCLDSSARAANTPCLESSGLWDDELDNCTDEVDVCPCSTRLAKRDSEK
EPCRGSRLPGSTNAVGSLPTSPDGDLPAYGPICGFSRSAVEMLDQETSELITTFFAEYTGLCATLQRRNEALSTLKRVVA
TVVEKHKFAYNGMIGKLSLNQQSDDMTVIKTVAERIFSDGTTNWGRIASLVAFGAEVCKYLKETGREHCVEAVGKQISSY
LLSEQRQWLLKNKAWDGFVEFFHVEDTESLVLQKVLVHVSECGSFELHDLKALCM
>gnl|bcl2dbpro|A0A3B3TCS4_BCL2-01 B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Paramormyrops kingsleyae GN=BCL-2 (length=230 residues).
MANDVPYDSRNIVEIYIYHKLLKTGYVWEFQAAGDTDSPNNGSVDSPPGSQVLARRSQAAAAGGEDASPVRSRTPRFDPH
ARLHRVLREAGDEIERMFQRDFSEMHEELHITPSTAQRRFTAVIEELFSDGVNWGRIVAFLEFGGTMCVESVNREMTSQV
DNIAHWMTEYLNGPLHNWIQENGGWDAFVEIYGQQRGSVMACFWPYLKTVFGLAALGAVGVTISAYFTKK
>gnl|bcl2dbpro|A0A3B3TFR4_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Paramormyrops kingsleyae GN=BCL2L1 (length=226 residues).
MSYSNRELVEYFVSYKLAQKNYSIAHIIQDEADEQTGGGEGEAAGAVAHANGSVSSGNSVGQGAPLEGATPQGLEAVKEA
LRLSANEFEFRYQRAFSDLSSQLHITPATAYQSFESVMNEVFRDGVNWGRVVGLFAFGGALCVECVEKEMSPLVGHIVDW
MTVYLDNHIQPWIQTQGGWDRFAEIFGNDAAAEGRRSRERFQQWLPAAMALVAGALVGFLIAKKRQ
© 1998-2019