Dataset for protein Bcl-xL of organism Paramormyrops kingsleyae

[Download (right click)] [Alignment] [Repertoires]

2 sequence(s)

>gnl|bcl2dbpro|A0A3B3QRZ2_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Paramormyrops kingsleyae GN=BCL2L1 (length=237 residues).
MSYSNRELVMDFITYKLSQRNYNGHFGLPEDRGRTEGSGQADGREGVMVTATHVNGSVIAGGTSSQVSPVPEQPLHSPSP
SPQGLEAVKEALRDSANEFELRYSRAFSDLSSQLHITPVTAYQSFESVMNEVFRDGINWGRIVGLFAFGGALCVECVEKE
MGHLVDRIADWMTVYLDSNIQPWIQRQGGWDRFAEIFGKDAAAESRRSQENFKKWLLAGMTLITGVVVGSLIAQKRL
>gnl|bcl2dbpro|A0A3B3TFR4_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Paramormyrops kingsleyae GN=BCL2L1 (length=226 residues).
MSYSNRELVEYFVSYKLAQKNYSIAHIIQDEADEQTGGGEGEAAGAVAHANGSVSSGNSVGQGAPLEGATPQGLEAVKEA
LRLSANEFEFRYQRAFSDLSSQLHITPATAYQSFESVMNEVFRDGVNWGRVVGLFAFGGALCVECVEKEMSPLVGHIVDW
MTVYLDNHIQPWIQTQGGWDRFAEIFGNDAAAEGRRSRERFQQWLPAAMALVAGALVGFLIAKKRQ
© 1998-2019