Dataset for protein BCL-2-like of organism Papio anubis

[Download (right click)] [Alignment] [Repertoires]

9 sequence(s)

>gnl|bcl2dbpro|A0A096MPU7_BCL2-01 B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Papio anubis GN=BCL-2 (length=238 residues).
MAHAGRTGYDNREIVMKYIHYKLSQRGYEWDAGDGAATPGAAPAPGIFSSQPGHTPHPAASRDPVARTSPLPTPAAPAAA
AGPALSPVPPVVHLTLRQAGDDFSRRYRRDFAEMSSQLHLTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVES
VNREMSPLVDNIALWMTEYLNRHLHTWIQDNGGWDAFVELYGPSMRPLFDFSWLSLKTLLSLALVGACITLGAYLGHK
>gnl|bcl2dbpro|A0A096NM44_BCL2L10-01 BCL2-like 10 protein OS=[Eukaryota] Papio anubis GN=BCL2L10 (length=231 residues).
MADPLRERTERLLADYLGCCAREPGTPEPRPSTPEAAVLRSAAARLRQLHRSFFSAYRGYPGNRVELVALMAEAVLSDSP
GPTWGRVVSLVTFAGTLLEREPLVTAWWKKRSFQPRLKEQEGDVARDCQRLVALLSSRLAGQHRAWLQAQGGWVSTRRTP
GRGAGRASGKRPRGRHGWLLSLLQEPLSAGFLEKTADPGFPGMLVSNSLRLSLDTIIMSFNIFNPLLPAQL
>gnl|bcl2dbpro|A0A096NMX5_BCL2A1-02 BCL2-related protein A1 protein OS=[Eukaryota] Papio anubis GN=BCL2A1 (length=163 residues).
MTDCEFGYIYRLAQDYLQYVLQIPQPGLGPSKTSRVLQKVAFSVQKEVEKNLKPCLDNVNVASIDTARTLFNQVMEKEFE
DGIINWGRIVTIFAFEGILIKKLLRQRIAPDVDTYKEISYFVAEFIMNNTGEWIRQNGGWGKWHNHMPMLVESVAHKKKK
MAL
>gnl|bcl2dbpro|A0A096NMX5_BCL2A1-01 BCL2-related protein A1 protein OS=[Eukaryota] Papio anubis GN=BCL2A1 (length=175 residues).
MTDCEFGYIYRLAQDYLQYVLQIPQPGLGPSKTSRVLQKVAFSVQKEVEKNLKPCLDNVNVASIDTARTLFNQVMEKEFE
DGIINWGRIVTIFAFEGILIKKLLRQRIAPDVDTYKEISYFVAEFIMNNTGEWIRQNGGWENGFVKKFEPKSGWMTFLEV
TGKICEMLSLLKQYC
>gnl|bcl2dbpro|A0A2I3M3D6_MCL1-02 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Papio anubis GN=MCL-1 (length=350 residues).
MFGLKRNAVIGLNLYCGGAGLGAGSGGATPPGGRLLATEKEASARREIGGGEAGTVIGGTAGASPPAALTPDARRVARPP
PIGAEVPDVTATPARPLFFAPTRRAAPLEEMEAPAADAIMSPEEELDGYEPEPLGKRPAVLPLLELVGESGNSPSTDGSL
PSTPPPAEEEEDELYRQSLEIISWYLREQATGAKDTKPMGRSGATSRKALETLRRVGDGVQRNHETAFQGMLRKLDIKNE
DDVKSLSRVMVHVFSDGVTNWGRIVTLISFGAFVAKHLKTINQESCIEPLAESITDVLVRTKRDWLVKQRGWDGFVEFFH
VEDLEGGIRNVLLAFAGVAGVGAGLAYLIR
>gnl|bcl2dbpro|A0A2I3M3D6_MCL1-01 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Papio anubis GN=MCL-1 (length=271 residues).
MFGLKRNAVIGLNLYCGGAGLGAGSGGATPPGGRLLATEKEASARREIGGGEAGTVIGGTAGASPPAALTPDARRVARPP
PIGAEVPDVTATPARPLFFAPTRRAAPLEEMEAPAADAIMSPEEELDGYEPEPLGKRPAVLPLLELVGESGNSPSTDGSL
PSTPPPAEEEEDELYRQSLEIISWYLREQATGAKDTKPMGRSGATSRKALETLRRVGDGVQRNHETAFQGWVCGVLPCRG
PRRWHQKCAAGFCRCCWSRSWFGISNKIALL
>gnl|bcl2dbpro|A0A2I3M3D6_MCL1-03 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Papio anubis GN=MCL-1 (length=197 residues).
MFGLKRNAVIGLNLYCGGAGLGAGSGGATPPGGRLLATGAKDTKPMGRSGATSRKALETLRRVGDGVQRNHETAFQGMLR
KLDIKNEDDVKSLSRVMVHVFSDGVTNWGRIVTLISFGAFVAKHLKTINQESCIEPLAESITDVLVRTKRDWLVKQRGWD
GFVEFFHVEDLEGGIRNVLLAFAGVAGVGAGLAYLIR
>gnl|bcl2dbpro|A0A2I3MUE4_BCL2L2-02 BCL2-like 2 protein OS=[Eukaryota] Papio anubis GN=BCL2L2 (length=193 residues).
MATPASAPDTRALVADFVGYKLRQKGYVCGAGPGEGPAADPLHQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQRFT
QVSDELFQGGPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQEWMVAYLETRLADWIHSSGGWAEFTALYGDGALEEAR
RLREGNWASVRTVLTGAVALGALVTVGAFFASK
>gnl|bcl2dbpro|A0A2I3MUE4_BCL2L2-01 BCL2-like 2 protein OS=[Eukaryota] Papio anubis GN=BCL2L2 (length=333 residues).
MATPASAPDTRALVADFVGYKLRQKGYVCGAGPGEGPAADPLHQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQRFT
QVSDELFQGGPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQEWMVAYLETRLADWIHSSGGWELEAIKARVREMEEEA
EKLKELQNEVEKQMNMSPPPGNAGPVIMSIEEKMEADARSIYVGNVDYGATAEELEAHFHGCGSVNRVTILCDKFSGHPK
GFAYIEFSDKESVRTSLALDESLFRGRQIKVIPKRTNRPGISTTDRGFPRARYRARTTNYNSSRSRFYSGFNSRPRGRVY
RGRARATSWYSPY
© 1998-2019