Dataset for protein Bfl1 of organism Papio anubis

[Download (right click)] [Alignment] [Repertoires]

2 sequence(s)

>gnl|bcl2dbpro|A0A096NMX5_BCL2A1-02 BCL2-related protein A1 protein OS=[Eukaryota] Papio anubis GN=BCL2A1 (length=163 residues).
MTDCEFGYIYRLAQDYLQYVLQIPQPGLGPSKTSRVLQKVAFSVQKEVEKNLKPCLDNVNVASIDTARTLFNQVMEKEFE
DGIINWGRIVTIFAFEGILIKKLLRQRIAPDVDTYKEISYFVAEFIMNNTGEWIRQNGGWGKWHNHMPMLVESVAHKKKK
MAL
>gnl|bcl2dbpro|A0A096NMX5_BCL2A1-01 BCL2-related protein A1 protein OS=[Eukaryota] Papio anubis GN=BCL2A1 (length=175 residues).
MTDCEFGYIYRLAQDYLQYVLQIPQPGLGPSKTSRVLQKVAFSVQKEVEKNLKPCLDNVNVASIDTARTLFNQVMEKEFE
DGIINWGRIVTIFAFEGILIKKLLRQRIAPDVDTYKEISYFVAEFIMNNTGEWIRQNGGWENGFVKKFEPKSGWMTFLEV
TGKICEMLSLLKQYC
© 1998-2019