Dataset for protein Bcl-2 of organism Papio anubis

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A096MPU7_BCL2-01 B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Papio anubis GN=BCL-2 (length=238 residues).
MAHAGRTGYDNREIVMKYIHYKLSQRGYEWDAGDGAATPGAAPAPGIFSSQPGHTPHPAASRDPVARTSPLPTPAAPAAA
AGPALSPVPPVVHLTLRQAGDDFSRRYRRDFAEMSSQLHLTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVES
VNREMSPLVDNIALWMTEYLNRHLHTWIQDNGGWDAFVELYGPSMRPLFDFSWLSLKTLLSLALVGACITLGAYLGHK
© 1998-2019