Dataset for protein Mcl-1 of organism Pan troglodytes

[Download (right click)] [Alignment] [Repertoires]

5 sequence(s)

>gnl|bcl2dbpro|G2HFR3_MCL1-01 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Pan troglodytes GN=MCL-1 (length=147 residues).
MDICRLSAAMREFYIVHLDIYPPPECTIHMLLDIKNEDDVKSLSRVMIHVFSDGVTNWGRIVTLISFGAFVAKHLKTINQ
ESCIEPLAESITDVLVRTKRDWLVKQRGWDGFVEFFHVEDLEGGIRNVLLAFAGVAGVGAGLAYLIR
>gnl|bcl2dbpro|K7DE58_MCL1-03 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Pan troglodytes GN=MCL-1 (length=197 residues).
MFGLKRNAVIGLNLYCGGAGLGAGSGGATPPGGRLLATGAKDTKPMGRSGATSRKALETLRRVGDGVQRNHETAFQGMLR
KLDIKNEDDVKSLSRVMIHVFSDGVTNWGRIVTLISFGAFVAKHLKTINQESCIEPLAESITDVLVRTKRDWLVKQRGWD
GFVEFFHVEDLEGGIRNVLLAFAGVAGVGAGLAYLIR
>gnl|bcl2dbpro|K7DE58_MCL1-02 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Pan troglodytes GN=MCL-1 (length=271 residues).
MFGLKRNAVIGLNLYCGGAGLGAGSGGATPPGGRLLATEKEASARREIGGGEAGAVIGGSAGASPPSTLTPDSRRVARPP
PIGAEVPDVTATPARLLFFAPTRRAAPLEEMEAPAADAIMSPEEELDGYEPEPLGKRPAVLPLLELVGESGNNTSTDGSL
PSTPPPAEEEEDELYRQSLEIISRYLREQATGAKDTKPMGRSGATSRKALETLRRVGDGVQRNHETAFQGWVCGVLPCRG
PRRWHQECAAGFCRCCWSRSWFGISNKIALL
>gnl|bcl2dbpro|K7DE58_MCL1-01 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Pan troglodytes GN=MCL-1 (length=350 residues).
MFGLKRNAVIGLNLYCGGAGLGAGSGGATPPGGRLLATEKEASARREIGGGEAGAVIGGSAGASPPSTLTPDSRRVARPP
PIGAEVPDVTATPARLLFFAPTRRAAPLEEMEAPAADAIMSPEEELDGYEPEPLGKRPAVLPLLELVGESGNNTSTDGSL
PSTPPPAEEEEDELYRQSLEIISRYLREQATGAKDTKPMGRSGATSRKALETLRRVGDGVQRNHETAFQGMLRKLDIKNE
DDVKSLSRVMIHVFSDGVTNWGRIVTLISFGAFVAKHLKTINQESCIEPLAESITDVLVRTKRDWLVKQRGWDGFVEFFH
VEDLEGGIRNVLLAFAGVAGVGAGLAYLIR
>gnl|bcl2dbpro|K7DE58_MCL1-04 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Pan troglodytes GN=MCL-1 (length=125 residues).
SVETCMLRKLDIKNEDDVKSLSRVMIHVFSDGVTNWGRIVTLISFGAFVAKHLKTINQESCIEPLAESITDVLVRTKRDW
LVKQRGWDGFVEFFHVEDLEGGIRNVLLAFAGVAGVGAGLAYLIR
© 1998-2019