Dataset for protein Bfl1 of organism Pan troglodytes

[Download (right click)] [Alignment] [Repertoires]

4 sequence(s)

>gnl|bcl2dbpro|A0A2I3T6T8_BCL2A1-03 BCL2-related protein A1 protein OS=[Eukaryota] Pan troglodytes GN=BCL2A1 (length=196 residues).
MTDCEFGYIYRLAQDYLQYVLQIPQPGSGPSKTSRVLQNVAFSVQKEVEKNLKSCLDNVNVVSVDTARTLFNQVMEKEFE
DGIINWGRIVTIFAFEGILIKKLLRQQIAPDVDTYKEISYFVAEFIMNNTGEWIRQNGGWENGFVKKFEHKSGWMTFLEV
TGKISILLTRKDTPYCETGLIFLTVMETIANTYFYF
>gnl|bcl2dbpro|A0A2I3T6T8_BCL2A1-01 BCL2-related protein A1 protein OS=[Eukaryota] Pan troglodytes GN=BCL2A1 (length=175 residues).
MTDCEFGYIYRLAQDYLQYVLQIPQPGSGPSKTSRVLQNVAFSVQKEVEKNLKSCLDNVNVVSVDTARTLFNQVMEKEFE
DGIINWGRIVTIFAFEGILIKKLLRQQIAPDVDTYKEISYFVAEFIMNNTGEWIRQNGGWENGFVKKFEHKSGWMTFLEV
TGKICEMLSLLKQYC
>gnl|bcl2dbpro|A0A2I3T6T8_BCL2A1-02 BCL2-related protein A1 protein OS=[Eukaryota] Pan troglodytes GN=BCL2A1 (length=163 residues).
MTDCEFGYIYRLAQDYLQYVLQIPQPGSGPSKTSRVLQNVAFSVQKEVEKNLKSCLDNVNVVSVDTARTLFNQVMEKEFE
DGIINWGRIVTIFAFEGILIKKLLRQQIAPDVDTYKEISYFVAEFIMNNTGEWIRQNGGWGKWHNHTPMLVESVAHKKRK
MAL
>gnl|bcl2dbpro|A0A2I3T6T8_BCL2A1-04 BCL2-related protein A1 protein OS=[Eukaryota] Pan troglodytes GN=BCL2A1 (length=71 residues).
VARSWLTAASTSTAQENGFVKKFEHKSGWMTFLEVTGKISILLTRKDTPYCETGLIFLTVMETIANTYFYF
© 1998-2019