Dataset for protein Unclassified of organism Pan paniscus

[Download (right click)]

3 sequence(s)

>gnl|bcl2dbpro|A0A2R8ZBL7_uncBCL2L1-02 Putative BCL2-like 1 protein OS=[Eukaryota] Pan paniscus (length=145 residues).
MWKRTGLRPQKGLNRRWRPPVPSMATHPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQVLVSRIAA
WMATYLNDHLEPWIQENGGWDTFVELYGNNAAAESRKGQERFNRWFLTGMTVAGVVLLGSLFSRK
>gnl|bcl2dbpro|A0A2R8ZBL7_uncBCL2L1-01 Putative BCL2-like 1 protein OS=[Eukaryota] Pan paniscus (length=233 residues).
MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGTESEMETPSAINGNPSWHLADSPAVNGATGHSSSLDAREV
IPMAAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQ
VLVSRIAAWMATYLNDHLEPWIQENGGWDTFVELYGNNAAAESRKGQERFNRWFLTGMTVAGVVLLGSLFSRK
>gnl|bcl2dbpro|A0A2R9B9U7_uncBCL2A1-01 Putative BCL2-related protein A1 protein OS=[Eukaryota] Pan paniscus (length=79 residues).
MVRSRLTATSVSQVQENGFVKKLEPKSGWMTFLEVTGKICEMLFCPEAILLTRKDTPYCETGLIFLTLMKTIANTYFYF
© 1998-2019