Dataset for protein Unclassified of organism Ovis aries

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|W5P8E8_uncBCL2-01 Putative B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Ovis aries (length=139 residues).
MAHAGGTGYDNREIVMKYIHYKLSQRGYESPPPRPRPGVSSPRPPRRDFAEMSSQLHLTPFTARGRFATVVEELFRDGVN
WGRIVAFFEFGGVMCVESVNREMSPLVDSIALWMTEYLNRHLHAWIQDNGGWVGARLGV
© 1998-2019