Dataset for protein BCL-2-like of organism Ovis aries

[Download (right click)] [Alignment] [Repertoires]

7 sequence(s)

>gnl|bcl2dbpro|Q9MZS7_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Ovis aries GN=BCL2L1 (length=233 residues).
MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGTESDMETPSAINGNPSWHLADSPAVNGATGHSRSLDAREV
IPMAAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQ
VLVSRIATWMATYLNDHLEPWIQENGGWDTFVELYGNNAAAESRKGQERFNRWFLTGMTVAGVVLLGSLFSRK
>gnl|bcl2dbpro|W5PSA5_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Ovis aries GN=BCL2L1 (length=233 residues).
MSQSNRELVVDFLSYKFFQKGYSWSQFSDMEENRTETLEGTESDMETPSAISGNPSWHLADSPVVNGATGHSRSLDTGKM
IPMAVVKQALREASNECELRYQQTFSDLTSQLHITPGKAYQSFEQVINELFQDGVNWGRNVAFFSFGGALCMKSIVKEMQ
VLVSQVTTWMATYLNDHLEPWIQENGDWDIFVELYENNTATESQKGQEHLNRWSLTDMTVAGMALLGLLFNCK
>gnl|bcl2dbpro|W5Q0N6_BCL2A1-01 BCL2-related protein A1 protein OS=[Eukaryota] Ovis aries GN=BCL2A1 (length=175 residues).
MTDTEFDYVHKLAEDYLKYVLQIQQPGSKPSKTSRVLQDVASSVQDEVERTLKQCLDKFDVVSVDTARTIFNQVMEKEFE
DGIVNWGRIVTIFAFEGILTKKLLSKRIASDMDMCKDISYFVAEFITKNTGEWIRQNGGWENGFVKKFETKSGWLTFLEV
TGKICETLCRLKQYY
>gnl|bcl2dbpro|W5QDH5_BCL2L2-01 BCL2-like 2 protein OS=[Eukaryota] Ovis aries GN=BCL2L2 (length=363 residues).
MGWPNLKYLLLGLSPYIHASLLCLTPTAARMATPASAPDTRALVADFVGYKLRQKGYVCGAGPGEGPAADPLHQAMRAAG
DEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDELFQGGPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQEWMVAYL
ETRLADWIHSSGGWELEAIKARVREMEEEAEKLKELQNEVEKQMNMSPPPGNAGPVIMSIEEKMEADARSIYVGNVDYGA
TAEELEAHFHGCGSVNRVTILCDKFSGHPKGFAYIEFSDKESVRTSLALDESLFRGRQIKVIPKRTNRPGISTTDRGFPR
ARYRARTTNYNSSRSRFYSGFNSRPRGRVYRGRARATSWYSPY
>gnl|bcl2dbpro|W5QDH5_BCL2L2-02 BCL2-like 2 protein OS=[Eukaryota] Ovis aries GN=BCL2L2 (length=223 residues).
MGWPNLKYLLLGLSPYIHASLLCLTPTAARMATPASAPDTRALVADFVGYKLRQKGYVCGAGPGEGPAADPLHQAMRAAG
DEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDELFQGGPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQEWMVAYL
ETRLADWIHSSGGWAEFTALYGDGALEEARRLREGNWASVRTVLTGAVALSLAEGSGRFFAES
>gnl|bcl2dbpro|W5QI41_MCL1-01 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Ovis aries GN=MCL-1 (length=268 residues).
GSRKPRPAPGPAPALTPPVRCRAQPPEAFAAFPIYGMQIKRQQQWFKMFGFKRRPAVRPLPLMVGEASNNSPGSDGSLPS
TPPPSEEEEDELYRQSLEIISQYLLEQATGTKDAKPLGGSGATSRKALETLRRVGDGVQRNHETAFQGMLRKLDIKNEDD
VKSLSRVMVHVFSDGVTNWGRIVTLISFGAFVAKHLKSINQESCIEPLAESITDVLVRSKRDWIVKQRGWDGFVEFFRVE
DLEGGIRNVLLAFAGVAGVGAGLAYLIR
>gnl|bcl2dbpro|W5QIG4_BCL2L10-01 BCL2-like 10 protein OS=[Eukaryota] Ovis aries GN=BCL2L10 (length=193 residues).
GRPPGRGGAMVDPFRERTARLLMDWLEFCAREPGTPAPAPSTPEAAVLRHVAARVLEANRNVLPLYRRYRRHRVELVARM
AQRLLDEDPGPSWGRVASLVTFAGSLLERQPQTTRRQKRDDGSVSRDCRLLVALLCAQFCERHRAWLMANGGWDGFCLSF
SHSLQPSWERQLVWFFLSYWTAIIIIYFWIKLS
© 1998-2019