Dataset for protein Bcl-w of organism Ovis aries

[Download (right click)] [Alignment] [Repertoires]

2 sequence(s)

>gnl|bcl2dbpro|W5QDH5_BCL2L2-01 BCL2-like 2 protein OS=[Eukaryota] Ovis aries GN=BCL2L2 (length=363 residues).
MGWPNLKYLLLGLSPYIHASLLCLTPTAARMATPASAPDTRALVADFVGYKLRQKGYVCGAGPGEGPAADPLHQAMRAAG
DEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDELFQGGPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQEWMVAYL
ETRLADWIHSSGGWELEAIKARVREMEEEAEKLKELQNEVEKQMNMSPPPGNAGPVIMSIEEKMEADARSIYVGNVDYGA
TAEELEAHFHGCGSVNRVTILCDKFSGHPKGFAYIEFSDKESVRTSLALDESLFRGRQIKVIPKRTNRPGISTTDRGFPR
ARYRARTTNYNSSRSRFYSGFNSRPRGRVYRGRARATSWYSPY
>gnl|bcl2dbpro|W5QDH5_BCL2L2-02 BCL2-like 2 protein OS=[Eukaryota] Ovis aries GN=BCL2L2 (length=223 residues).
MGWPNLKYLLLGLSPYIHASLLCLTPTAARMATPASAPDTRALVADFVGYKLRQKGYVCGAGPGEGPAADPLHQAMRAAG
DEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDELFQGGPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQEWMVAYL
ETRLADWIHSSGGWAEFTALYGDGALEEARRLREGNWASVRTVLTGAVALSLAEGSGRFFAES
© 1998-2019