Dataset for protein Mcl-1 of organism Otolemur garnettii

[Download (right click)] [Alignment] [Repertoires]

2 sequence(s)

>gnl|bcl2dbpro|H0XFB7_MCL1-01 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Otolemur garnettii GN=MCL-1 (length=350 residues).
MFGLKRNAVIGLNLYCGGAGLGAGSGGATPPGGRLLAAEKEAAARREAGGGEAGEVIGGSPGASSPASLTPDARRVARPP
PIGAEVPDVTATPTRLLFFAPTLRAAPREEMEAPAADAIMSPEDELDGYEPEPLGKRPAVLPLLELVGEASNGPSTDGSL
PSTPPPAEEEEDELYRQSLEIISRYLREQATGAKDAKPMGRAGAASRKALETLRRVGDGVQRNHETAFQGMLRKLDIKNE
DDVKSLSRVMVHVFSDGVTNWGRIVTLISFGAFVAKHLKSINQESCIEPLAESITDVLVRTKRDWLVKQRGWDGFVEFFH
VEDLEGGIRNVLLAFAGVAGVGAGLAYLIR
>gnl|bcl2dbpro|H0XHA5_MCL1-01 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Otolemur garnettii GN=MCL-1 (length=193 residues).
LPDQMEAQVADAVKSPEGEVASCEPEPLKKQPEGLPLLEFVGEAGNGPSTDTLPSTPPPAEEEDELYWQSMEIISRYLWE
QETGEDINSLSRVMAHVFSYGVTNWGRIMTLIFGGFVAKHLKTINQEGYIKPLEENIADVLVRTKPDWLVKQRGWDGFVE
FFYLEDLESSVRNVLLAFAGVAGVGAGLTYLIR
© 1998-2019