Dataset for protein BCL-2-like of organism Osmerus mordax

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|C1BLI0_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Osmerus mordax GN=BCL2L1 (length=222 residues).
MSYSNRELVVFFISYKLSQRNYPISQLGLEDASERTNVDKTNVSPVNGSVENDRNCIGSLGISSSPQGGIEAVKAALRDS
ADEFELRYTRAFNDPSSQLHITPATAYHSFESVMNEVFRDGVNWGRVVGLFAFGGALCAECVEKDMSHLVARIADWMTTY
LDNHIQPWIQRQGGWDRFADIFGRDAAAEVRRSQENLRRWLLVGAILLAGVLVGSLIAKKHH
© 1998-2019