Dataset for protein BCL-2-like of organism Oryzias melastigma

[Download (right click)] [Alignment] [Repertoires]

5 sequence(s)

>gnl|bcl2dbpro|A0A3B3C5I4_BCL2L10-01 BCL2-like 10 protein OS=[Eukaryota] Oryzias melastigma GN=BCL2L10 (length=201 residues).
MDGFSAQKMSCGLRKETLAVALDYLSLSCRSPVLQAPPPPSESASAMRRLAQDMETQYQPRFSTLAQDFRKHCGPDLCSS
LRKVMEELVGDEHLNWGRVVSLFAFVGVLARQLREQTDTNPGLDLGREAAPGPVSCQALAETVADFLGGDKKEWMLENDG
WEGFCKFSRTAREVSQDSSMKTALFAAASVGLAGLTFLLVR
>gnl|bcl2dbpro|A0A3B3CEX1_MCL1-02 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Oryzias melastigma GN=MCL-1 (length=270 residues).
MLPLQKHMVNSYITPSCGCTALFGGAGERSARVPLTSATASRGANPDPSEQMKRPQDLDMLGNKSPYAARRFHDDDGGSL
PNTPELECDNSVLVPNDPPINQDTTEFLTNFFRNYVGLSQSRHRESKYISTAKRVVNDMMDKHRFAFNGMINRLSLEDNL
DDMSFISRVAENMFADRTTNWGRIASLLAFGAAVCLQLKEKGRGHSVDLVSQEICTYLLREQRDWLINNNSWDGFVEFFH
VPDPESTVRNTLVAVLGLAGVGALLAQVCR
>gnl|bcl2dbpro|A0A3B3CEX1_MCL1-01 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Oryzias melastigma GN=MCL-1 (length=301 residues).
MLPLQKHMVNSYITPSCGCTALFGGAGERSARVPLTSATASRGANPDPSEQMKRPQDLDMLGNKSPYAARRFHDDDGGSL
PNTPELECDNSVLVPNDPPINQDTTEFLTNFFRNYVGLSQSRHRESKYISTAKRVVNDMMDKHRFAFNGMINRLSLEDNL
DDMSFISRVAENMFADRTTNWGRIASLLAFGAAVCLQLKEKGRGHSVDLVSQEICTYLLREQRDWLINNNSWDGFVEFFH
VPDPESTVRNTLVAVLGLAGVGALLAQVQGPYRIWQDMTSCHTNLSKNKVGRSPSFAVEGP
>gnl|bcl2dbpro|A0A3B3DHA1_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Oryzias melastigma GN=BCL2L1 (length=230 residues).
MSRNRELVVFYVKYKLSQRNYPLNHIVLNESPNRTAAGEVGEEQSTETHANGTFNGTSPGTPPLSPLRQQQLPSTTNMDA
VKEALRDTANEFELRYALAFNNLHSQLHITPATAYQSFENVMNELFRDNINWGRIVGLFAFGGALCVECVEKEMSPLVDR
IVEWMTVYLDNHIQPWIQSQGGWERFAEIFGQEAAAESRRSQESFKKWLLVGMTVATGVLVGSFIAQKRL
>gnl|bcl2dbpro|A0A3B3E2W4_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Oryzias melastigma GN=BCL2L1 (length=217 residues).
MSHCNRELVQFYLGYKMSSRDYPVSLLKPTDDGGQTAEDRSATCNGTLVNSEDGQLKKSCPCCASMDAIKSTLKDSANEF
ERRFSQGFSDLSLQFHITPDTAYQNFKSVLDELFKDGINWGRVVGLFVFGGVLCVECVERNMSELVSRIAEWMTMYLDEQ
ISPWIHSQGGWDCFAQLYGQDGAAEARRFQETLKKWTLVAVALLTGLLLGLLIAKKR
© 1998-2019