Dataset for protein Bcl-xL of organism Oryzias melastigma

[Download (right click)] [Alignment] [Repertoires]

2 sequence(s)

>gnl|bcl2dbpro|A0A3B3DHA1_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Oryzias melastigma GN=BCL2L1 (length=230 residues).
MSRNRELVVFYVKYKLSQRNYPLNHIVLNESPNRTAAGEVGEEQSTETHANGTFNGTSPGTPPLSPLRQQQLPSTTNMDA
VKEALRDTANEFELRYALAFNNLHSQLHITPATAYQSFENVMNELFRDNINWGRIVGLFAFGGALCVECVEKEMSPLVDR
IVEWMTVYLDNHIQPWIQSQGGWERFAEIFGQEAAAESRRSQESFKKWLLVGMTVATGVLVGSFIAQKRL
>gnl|bcl2dbpro|A0A3B3E2W4_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Oryzias melastigma GN=BCL2L1 (length=217 residues).
MSHCNRELVQFYLGYKMSSRDYPVSLLKPTDDGGQTAEDRSATCNGTLVNSEDGQLKKSCPCCASMDAIKSTLKDSANEF
ERRFSQGFSDLSLQFHITPDTAYQNFKSVLDELFKDGINWGRVVGLFVFGGVLCVECVERNMSELVSRIAEWMTMYLDEQ
ISPWIHSQGGWDCFAQLYGQDGAAEARRFQETLKKWTLVAVALLTGLLLGLLIAKKR
© 1998-2019