Dataset for protein Unclassified of organism Oryzias latipes

[Download (right click)]

2 sequence(s)

>gnl|bcl2dbpro|H2MQI3_uncBCL2-02 Putative B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Oryzias latipes (length=189 residues).
MANVSNRSIVEKYICHKLSKRGYVCGLNGGQRENASSPRLIRAVLREAGDELERLYQRDFTEMSRQLYLTSTTAKTRFAE
VIDELFRDGVNWGRIIAFFEFGGTVCVECASNEEMSTQVASIAEWMTEYLNGPLNSWIEENGGWDAFVELYDRQKETVFT
CYWPSIKTVFGLAALGAASLTIGAYLAQK
>gnl|bcl2dbpro|H2MQI3_uncBCL2-01 Putative B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Oryzias latipes (length=202 residues).
MANVSNRSIVEKYICHKLSKRGYVCGLNGGQRENAESSPRLIRALSRADPLADIHRVLREAGDELERLYQRDFTEMSRQL
YLTSTTAKTRFAEVIDELFRDGVNWGRIIAFFEFGGTVCVECASNEEMSTQVASIAEWMTEYLNGPLNSWIEENGGWDAF
VELYDRQKETVFTCYWPSIKTVFGLAALGAASLTIGAYLAQK
© 1998-2019