Dataset for protein BCL-2-like of organism Oryzias latipes

[Download (right click)] [Alignment] [Repertoires]

8 sequence(s)

>gnl|bcl2dbpro|A0A3B3IB64_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Oryzias latipes GN=BCL2L1 (length=230 residues).
MSRNRELVVFYVKYKLSQRNYPLNHIVLNESPNRTAAGEVGEEQSTETHANGTFNGTTPGTPPLSPLREQQLPSTTNMDA
VKEALRDTANEFELRYALAFNNLHSQLHITPATAYQSFENVMNELFRDNINWGRIVGLFAFGGALCVECVEKEMSPLVDR
IVEWMTVYLDNHIQPWIQSQGGWERFAEIFGQEAAAESRRSQESFKKWLLVGMTVATGVLVGSFLAQKRL
>gnl|bcl2dbpro|A0A3B3ICL7_BCL2L1-02 BCL2-like 1 protein OS=[Eukaryota] Oryzias latipes GN=BCL2L1 (length=214 residues).
MTKWKKSWHLTYKMSCRDYPVSLLKPTDDGGETEEDHSDARNRRLVSSEDGRLRRSCPCCASMDAIKSTLKDSADEFERR
FHQGFSDLSVQLHITPDTAYQNFKRVLDELFKDGINWGRVVGLFVFGGALCVECVERNMGELVSRIAEWMTQYLDEQISP
WIHSHGGWDCFARLYGQNGAAEARRFQETLKKWMLVTVALLTGLLLGVLITKKR
>gnl|bcl2dbpro|A0A3B3ICL7_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Oryzias latipes GN=BCL2L1 (length=217 residues).
MSHCNRELVRFYLAYKMSCRDYPVSLLKPTDDGGETEEDHSDARNRRLVSSEDGRLRRSCPCCASMDAIKSTLKDSADEF
ERRFHQGFSDLSVQLHITPDTAYQNFKRVLDELFKDGINWGRVVGLFVFGGALCVECVERNMGELVSRIAEWMTQYLDEQ
ISPWIHSHGGWDCFARLYGQNGAAEARRFQETLKKWMLVTVALLTGLLLGVLITKKR
>gnl|bcl2dbpro|A0A3P9JYH1_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Oryzias latipes GN=BCL2L1 (length=230 residues).
MSRNRELVVFYVKYKLSQRNYPLNHIVLNESPNRTAAGEVGEEQSTETHANGTFNGTTPGTPPLSPLREQQLPSTTNMDA
VKEALRDTANEFELRYALAFNNLHSQLHITPATAYQSFENVMNELFRDNINWGRIVGLFAFGGALCVECVEKEMSPLVDR
IVEWMTVYLDNHIQPWIQSQGGWERFAEIFGQEAAAESRRSQESFKKWLLVGMTVATGVLVGSFLAQKRL
>gnl|bcl2dbpro|A0A3P9LM07_BCL2L10-01 BCL2-like 10 protein OS=[Eukaryota] Oryzias latipes GN=BCL2L10 (length=192 residues).
MSCGLRKETLAVALDYLSLSCRSPLQAPPPPSESAAAMRRLAQDMEAQYQPRFSTLAQNFRKHSGPDLCSSLRKVMEELV
GDERLNWGRVVSLFAFVGVLARQLREQTDMNPGLDPGREVAPGPVSCQALAETVADFLGGDKKEWMLENDGWEGFCKFSR
TAREVSQDSSMKTALFAAASVGLAGLTFLLVR
>gnl|bcl2dbpro|H2MBQ3_BCL2L10-01 BCL2-like 10 protein OS=[Eukaryota] Oryzias latipes GN=BCL2L10 (length=192 residues).
MSCGLRKETLAVALDYLSLSCRSPLQAPPPPSESAAAMRRLAQDMEAQYQPRFSTLAQNFRKHSGPDLCSSLRKVMEELV
GDERLNWGRVVSLFAFVGVLARQLREQTDMNPGLDPGREVAPGPVSCQALAETVADFLGGDKKEWMLENDGWEGFCKFSR
TAREVSQDSSMKTALFAAASVGLAGLTFLLVR
>gnl|bcl2dbpro|H2MLZ3_MCL1-01 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Oryzias latipes GN=MCL-1 (length=268 residues).
MFPLQKQMVNSYITSNCGFTGHILGSRAGEMSARVPLPSTLASHVANPDPSDQLKRPQDLEYSARRFHDVDDDGSLPNTP
ELECEASVSGDNSGIDALNEDTTEFLTNFFRNFVGISQYRHRDNKYMSTAKRVVNDVLEKHKITYNGMIVRLSLDDQGDD
MSFVSSVAKSLFADGTTNWGRIVSLLAFGAAVCQSLKEKGRGHCVDLVSQEICTYLLSEQRNWLVNNNSWDGFVEFFRVS
DPETTVRNTLVAFLGIAGVGALLAQLSR
>gnl|bcl2dbpro|H2MLZ3_MCL1-02 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Oryzias latipes GN=MCL-1 (length=285 residues).
MFPLQKQMVNSYITSNCGFTGHILGSRAGEMSARVPLPSTLASHVANPDPSDQLKRPQDLEYSARRFHDVDDDGSLPNTP
ELECEASVSGDNSGIDALNEDTTEFLTNFFRNFVGISQYRHRDNKYMSTAKRVVNDVLEKHKITYNGMIVRLSLDDQGDD
MSFVSSVAKSLFADGTTNWGRIVSLLAFGAAVCQSLKEKGRGHCVDLVSQEICTYLLSEQRNWLVNNNSWDGFVEFFRVS
DPETTVRNTLVAFLGIAGVGALLAQLNMMAIFKGLPASTRLHNSR
© 1998-2019