Dataset for protein Bcl-w of organism Oryctolagus cuniculus

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|G1TV33_BCL2L2-01 BCL2-like 2 protein OS=[Eukaryota] Oryctolagus cuniculus GN=BCL2L2 (length=216 residues).
LSLCLHIPDIHAGLSSLPLTAARMATPASAPDTRALVADFVGYKLRQKGYVCGAGPGEGPAANPLHQAMRAAGDEFETRF
RQNFSDLAAQLHVTPGSAQQSFTQVCDELFQRGPNWGRVVAFFAFGAALCAESVNKEMEPLVGQVQEWMVTYLETQLAGW
IHSTGGWAEFTALYGDRALEEARRLREGTWASVRTVLTGAVALGALVTVGAFFASK
© 1998-2019