Dataset for protein Bcl2l10 of organism Oryctolagus cuniculus

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|G1T264_BCL2L10-01 BCL2-like 10 protein OS=[Eukaryota] Oryctolagus cuniculus GN=BCL2L10 (length=191 residues).
RPQRRLAMADALEERTARLLTDYLECCAREPGTPEPQPSTPEAAVLRCAATQLQRVHWPFFSVYRGYPGNRIELAARVAE
AVLSDGHDLSWGRVVTLVTFAGTLLDRGPPVTTQRVRRNEIARDCQRLVALLCARLAGQHRAWLQAQGGWDGFCVFYRTP
LPLTFWRRLLVRTFLSCFVATALLFAWTRVY
© 1998-2019