Dataset for protein Bfl1 of organism Oryctolagus cuniculus

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|G1T1L8_BCL2A1-01 BCL2-related protein A1 protein OS=[Eukaryota] Oryctolagus cuniculus GN=BCL2A1 (length=199 residues).
MFASQGFGSFQKKQSPALLSEQQKMSDCEFGYVHTLAQDYLLYILKTPQPGLGPSKTSRVLQNVTFSIQQEVEEALQPYL
HNVPVASVETARTIFNQVMEKEFEDGVINWGRIVTIFAFEGVLAKKLLQEQAVPDVDTFKSIPYFVAEFITRRMGEWIRQ
NGGWENGFVKKFEHNSGWKIFLEVAKQICVILSLLKKYC
© 1998-2019