Dataset for protein Bcl-2 of organism Oryctolagus cuniculus

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|G1TW27_BCL2-01 B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Oryctolagus cuniculus GN=BCL-2 (length=226 residues).
MAHAGRTGYDNREIVMKYIHYKLSQRGYEWDAGDAGAASAPGVFSSQPAPAAPRDPAARTSPPPPPAAAGPALSPVPPVV
HLTLRQAGDDFSRRYRRDFAEMSSQLHLTPFHARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNREMSPLVDNI
ALWMTEYLNRHLHTWIQDNGGWDAFVELYGPSVRPLSDFSWVSLKTLFSLALIGACITLGAYLGHK
© 1998-2019