Dataset for protein BCL-2-like of organism Ornithorhynchus anatinus

[Download (right click)] [Alignment] [Repertoires]

2 sequence(s)

>gnl|bcl2dbpro|F6S8G3_BCL2A1-01 BCL2-related protein A1 protein OS=[Eukaryota] Ornithorhynchus anatinus GN=BCL2A1 (length=175 residues).
MDDGVFWSVRALALDYLDDVLQTPRLGTVPSRTSRALQNVMFSVQGDVEKALKPCFDSLDVGSVGAARRIFGQIVEKEFE
DGIVNWGRIVTIFVLGGILTKKLQRSGVPLTRETREEISCFIAEFTTHHAGEWIRQNGGWENGFLNKFEQKTVWSVLADI
SMKILGVLSHLKQFY
>gnl|bcl2dbpro|F7G6M3_BCL2L2-01 BCL2-like 2 protein OS=[Eukaryota] Ornithorhynchus anatinus GN=BCL2L2 (length=244 residues).
MPSARNSPLPRQSAAPQPCCLAPCPSRPPGSPPDAPPRPPPPRCPAAPRMATPAPASVSDTRALVADFVGYKLRQKGFAC
GAGPGEGPPAQPLHRAMRAAGDEFESRFRRAFSDLASQLHVTPGSAQQRFTQVSDELFQGGPNWGRLVAFFVFGAALCAE
SVNKEMEPLVGQVQDWMVAYLDTQLADWIRSSGGWAEFTALYGDGALEDARRLREGNWASVRTVLTGAVALGALVTVGAF
FASK
© 1998-2019