Dataset for protein Bcl-w of organism Ornithorhynchus anatinus

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|F7G6M3_BCL2L2-01 BCL2-like 2 protein OS=[Eukaryota] Ornithorhynchus anatinus GN=BCL2L2 (length=244 residues).
MPSARNSPLPRQSAAPQPCCLAPCPSRPPGSPPDAPPRPPPPRCPAAPRMATPAPASVSDTRALVADFVGYKLRQKGFAC
GAGPGEGPPAQPLHRAMRAAGDEFESRFRRAFSDLASQLHVTPGSAQQRFTQVSDELFQGGPNWGRLVAFFVFGAALCAE
SVNKEMEPLVGQVQDWMVAYLDTQLADWIRSSGGWAEFTALYGDGALEDARRLREGNWASVRTVLTGAVALGALVTVGAF
FASK
© 1998-2019