Dataset for protein Unclassified of organism Oreochromis niloticus

[Download (right click)]

4 sequence(s)

>gnl|bcl2dbpro|I3JTS4_uncBCL2-01 Putative B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Oreochromis niloticus (length=225 residues).
AGMANEYNRNIVEKYICHKLSKRGYVWGFRVVQEEDAANNGSITDPPPTLVHRCREASTGPDGESNTHLCRRLPQSDPHA
GIHRVLREAGDELERLYQPDFTEMSRQLHLTSATAQRRFAEVIDELFRDGVNWGRIIAFFEFGGTVCVECASNEGMSSQV
DNIADWMTEYLNGPLNSWIQDNGGWSANLQPLCLTCRPLFASWLGLFCLPFSDLCLEAGADWGRR
>gnl|bcl2dbpro|I3KLB2_uncBCL2-02 Putative B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Oreochromis niloticus (length=147 residues).
QGAMAAAYNSRDLVEDFLRYKLLGRGVAWPQHPPVAPPRLQAVLRSASDELERLHGNELSAQVTVLRLRGNGGGAARRRH
LTAIREELFRDGVNWGRIVTMMELGGALSAAAAKSGDEGQVDDIASWMEESLDSPSLRRWIHDNGGW
>gnl|bcl2dbpro|I3KLB2_uncBCL2-01 Putative B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Oreochromis niloticus (length=169 residues).
PPSPLANTTGPSDPPVAPPRLQAVLRSASDELERLHGNELSAQVTVLRLRGNGGGAARRRHLTAIREELFRDGVNWGRIV
TMMELGGALSAAAAKSGDEGQVDDIASWMEESLDSPSLRRWIHDNGGWDAFVELYESRPTDSFWSLRTVLGLVVLGAVGV
ILGFLFSQK
>gnl|bcl2dbpro|I3KWT0_uncBCL2L1-01 Putative BCL2-like 1 protein OS=[Eukaryota] Oreochromis niloticus (length=198 residues).
EMQCSNRELVEFFISYKLSQKNHPTSLLRPTNGGQRTERDLAQSLPAYNGIEALKSALLDSGEQFGFLFTQSFRDVASHL
SITPDTAQQCFESVMEELFRDGINWGRIIGLFVFGSAMCLDCIDSNMSELVPDIADWMTAYLDDHISLWIQRNGGWDRFT
EIFGKGMSTRSSGESLKRWLFVGVALVTGLLVGMLMTD
© 1998-2019