Dataset for protein BCL-2-like of organism Oreochromis niloticus

[Download (right click)] [Alignment] [Repertoires]

4 sequence(s)

>gnl|bcl2dbpro|I3IZK7_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Oreochromis niloticus GN=BCL2L1 (length=234 residues).
YKMSQNRELVLFYIRYKLSQRNYPLNHIVLNEPLNRTDGGAAGLDEEQRIDTHANGTFNGTSPGTPPASPQRQQQPPSTT
DLDAVKEALRDTANEFELRYARAFSDLHSQLHITPATAYQSFENVMDEVFRDGVNWGRIVGLFAFGGALCVECVEKEMSP
LVGRIVEWMTVYLDNHIQPWIQSQGGWERFAEIFGQDAAAESRRSQESFKKWLLVGMTVVTGVVAGALIAQKRL
>gnl|bcl2dbpro|I3J363_BCL2L10-01 BCL2-like 10 protein OS=[Eukaryota] Oreochromis niloticus GN=BCL2L10 (length=235 residues).
MSRGGVTHSLSAEGKTQLYRRSPSAVCMCREQSDIAGRKMKFCGLWKETLLLAEDYLSFCCTSPHQAPPPPSESAAAMRR
LGWDIERQHQARFDNLAQTFLVQCGPDHCLSLRKVMKELVGDGHLNWGRVVSLFAFTGVLARKILEQKPGLDPGQQQELG
QEPMSCRRLAETIADYLGEEKKDWLLDNDGWEGFCKFSRSAREVSQDSSMKKALFAAAGVGLAGLTFLLVKGFRF
>gnl|bcl2dbpro|I3JHR5_MCL1-01 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Oreochromis niloticus GN=MCL-1 (length=278 residues).
MTNFLMSKRNQCTFIDYLLPQNGVLEGPMHYGSGKSSPQNATGSSKDSSNGIVSNGTPKRPNNLGVTSTNGYTTKAIRDR
EEDGSLPSTPEYHLDGESDEELERETKLLIHSFLGDFTGLSQPQRKETKALKTMKRVVADVLEKHRYAYNGMINKLSLDE
RHEDMSFVGAVAKSLFADHTTNWGRIVSFVAFGAVVSQHLKEKGRDNCVALVSQEVSAYLLSEQRDWIVKNNAWDGFVEF
FRVADPESTVRNTLMAFAGFAGIGATLALLIRFWDALL
>gnl|bcl2dbpro|I3KXG5_MCL1-01 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Oreochromis niloticus GN=MCL-1 (length=168 residues).
LERETKLIIHSFLGDFTGLSQPQRKETKALKMMKRVVADVLEKHRYAYNGMINKLSLDEREEDMSFVAKSLFGDHTTNWG
RIVSFVAFGAVVSQHLKEKGRDNCVVLVSQEISAYLLSEQRDWIIKNNAWDGFVAFVRVADPESIVRNTLMAFAGFACIG
ATLALLIR
© 1998-2019