Dataset for protein Bcl2l10 of organism Oreochromis niloticus

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|I3J363_BCL2L10-01 BCL2-like 10 protein OS=[Eukaryota] Oreochromis niloticus GN=BCL2L10 (length=235 residues).
MSRGGVTHSLSAEGKTQLYRRSPSAVCMCREQSDIAGRKMKFCGLWKETLLLAEDYLSFCCTSPHQAPPPPSESAAAMRR
LGWDIERQHQARFDNLAQTFLVQCGPDHCLSLRKVMKELVGDGHLNWGRVVSLFAFTGVLARKILEQKPGLDPGQQQELG
QEPMSCRRLAETIADYLGEEKKDWLLDNDGWEGFCKFSRSAREVSQDSSMKKALFAAAGVGLAGLTFLLVKGFRF
© 1998-2019