Dataset for protein Bcl-xL of organism Oncorhynchus mykiss

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A286MU87_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Oncorhynchus mykiss GN=BCL2L1 (length=216 residues).
MSYSNRELVVFFISYRLSQRNYSCCQLGLEGASGRTDGDEAIANGSVGNYRNSRSNLAKPSSPQGGMEPVKAALRDSVDE
FELRYTRAFSDLSSQLHITPATAYHSFESVMDEVFRDGVNWGRVVGLFAFGGALCVECVEKDMSPLVARIADWMTTYLDN
HIQPWIQSQGGWAEIFGRDAAADVRRSQESIIKWLLVGVILLSGVLVGTLIMKKRQ
© 1998-2019