Dataset for protein Bcl-xL of organism Odontesthes bonariensis

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|C3VIT1_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Odontesthes bonariensis GN=BCL2L1 (length=235 residues).
MSQNRELVVFYIKYKLSQRNYPLNHIVLNEPPNRTGAGDGGLGEEQSTETHANGTFTGTSPGTPPVSPLRQQPLPSTTTT
TRLDAVKEALRDTANEFELRYARAFSDLHSQLHITPATAYQSFENVMDEVFRDGVNWGRIVGLFAFGGALCVECVEREMS
PLVGRIVEWMTVYLDNHIQPWIQSQGGWERFAEIFGQDAAAESRRSQESFKKWLLVGMTVVTGVVVGSLFAQKRL
© 1998-2019