Dataset for protein Unclassified of organism Octopus bimaculoides

[Download (right click)]

2 sequence(s)

>gnl|bcl2dbpro|A0A0L8G405_uncBCL2L1-01 Putative BCL2-like 1 protein OS=[Eukaryota] Octopus bimaculoides (length=212 residues).
MGSSSNNNSEMNVPVSRYLLEDYVNYRLRRQGFTWENCPCFDRRPSKVAISMRAMADEFEERYHDQFSNMCQQLHITQHT
AYCTFQAVINELFSDQTINWGRIVALFSFSGALSLQSVEKEMPYLVDNIVEWAHTYLTDNLNTWINAHGGWEDKDKIESL
DKLKILCLVHAGSYFMLNHPTQIRLEPGAAAGSPGLSQTVQPMPAWKAVVKR
>gnl|bcl2dbpro|A0A0L8HGC1_uncBCL2-01 Putative B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Octopus bimaculoides (length=206 residues).
MVSVLTNIFCSINSSPVMHPLQSVIRMDKEENLKSCRKEVPRMVKDMVLNFDKGHFISQPESDICAGMRKSVLEIYNIYR
DALYKNVAQLLDEVADDLTIQKAYRCVVETILEDRKNLHWRRISMVFTMLAVLAEDQRSKHHDLSWEQYNQILIKLFKEH
KIDTWINDNSGWDGFLEHIQMKHKNKLEEFIWLSTIGLWSLSVSGL
© 1998-2019