Dataset for protein BCL-2-like of organism Nomascus leucogenys

[Download (right click)] [Alignment] [Repertoires]

11 sequence(s)

>gnl|bcl2dbpro|A0A2I3GB35_MCL1-01 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Nomascus leucogenys GN=MCL-1 (length=271 residues).
MFGLRRNAVIGLNLYCGGAGLGAGSGGATPPGGRLLATEKEASARREIGGGEAGAVIGGSAGASPPSVLTPDSRRVARPP
PIGAEVSDVTATPARLLFFAPTRRAAPLEEMEAPAADAIMSPEEELDGYEPEPLGKRPAVLPLLELVGESGNNTSTDGSL
PSTPPPAEEEEDELYRQSLEIISRYLREQATGAKDTKPMGRSGATSRKALETLRRVGDGVQRNHETAFQGWVCGVLPCRG
PRRWHQKCAAGFCRCCWSRSWFGISNKIALL
>gnl|bcl2dbpro|A0A2I3GB35_MCL1-03 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Nomascus leucogenys GN=MCL-1 (length=147 residues).
MFGLRRNAVIGLNLYCGGAGLGAGSGGMLRKLDIKNEDDVKSLSRVMVHVFSDGVTNWGRIVTLISFGAFVAKHLKTINQ
ESCIEPLAESITDVLVRTKRDWLVKQRGWDGFVEFFHVEDLEGGIRNVLLAFAGVAGVGAGLAYLIR
>gnl|bcl2dbpro|A0A2I3GB35_MCL1-02 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Nomascus leucogenys GN=MCL-1 (length=350 residues).
MFGLRRNAVIGLNLYCGGAGLGAGSGGATPPGGRLLATEKEASARREIGGGEAGAVIGGSAGASPPSVLTPDSRRVARPP
PIGAEVSDVTATPARLLFFAPTRRAAPLEEMEAPAADAIMSPEEELDGYEPEPLGKRPAVLPLLELVGESGNNTSTDGSL
PSTPPPAEEEEDELYRQSLEIISRYLREQATGAKDTKPMGRSGATSRKALETLRRVGDGVQRNHETAFQGMLRKLDIKNE
DDVKSLSRVMVHVFSDGVTNWGRIVTLISFGAFVAKHLKTINQESCIEPLAESITDVLVRTKRDWLVKQRGWDGFVEFFH
VEDLEGGIRNVLLAFAGVAGVGAGLAYLIR
>gnl|bcl2dbpro|A0A2I3GZF9_BCL2-01 B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Nomascus leucogenys GN=BCL-2 (length=239 residues).
MAHAGRTGYDNREIVMKYIHYKLSQRGYEWDAGDVGAAPPGAAPAPGIFSSQPGHTPHPAASRDPVARTSPLPTPAAPGA
AAGPALSPVPPVVHLTLRQAGDDFSRRYRRDFAEMSSQLHLTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVE
SVNREMSPLVDNIALWMTEYLNRHLHTWIQDNGGWDAFVELYGPSMRPLFDFSWLSLKTLLSLALVGACITLGAYLGHK
>gnl|bcl2dbpro|A0A2I3HNF3_BCL2A1-01 BCL2-related protein A1 protein OS=[Eukaryota] Nomascus leucogenys GN=BCL2A1 (length=175 residues).
MTDCEFGYIYRLAQDYLQYVLQIPQPGSGPSKTSRVLQNVAFSVQKEVEKNLKPCLDNVNVVSIDTARTLFNQVMEKEFE
DGIINWGRIVTIFAFEGILVKKLLRQRTAPDVDTYKEISYFVAEFIMNNTGEWIRQNGGWENGFVKKFEPKSGWMTFLEV
TGKICEMLSFLKQYC
>gnl|bcl2dbpro|A0A2I3HNF3_BCL2A1-02 BCL2-related protein A1 protein OS=[Eukaryota] Nomascus leucogenys GN=BCL2A1 (length=163 residues).
MTDCEFGYIYRLAQDYLQYVLQIPQPGSGPSKTSRVLQNVAFSVQKEVEKNLKPCLDNVNVVSIDTARTLFNQVMEKEFE
DGIINWGRIVTIFAFEGILVKKLLRQRTAPDVDTYKEISYFVAEFIMNNTGEWIRQNGGWGKWHNHMPMLVESVAHKKRK
MAL
>gnl|bcl2dbpro|A0A2I3HNF3_BCL2A1-03 BCL2-related protein A1 protein OS=[Eukaryota] Nomascus leucogenys GN=BCL2A1 (length=205 residues).
MTDCEFGYIYRLAQDYLQYVLQIPQPGSGPSKTSRVLQNVAFSVQKEVEKNLKPCLDNVNVVSIDTARTLFNQVMEKEFE
DGIINWGRIVTIFAFEGILVKKLLRQRTAPDVDTYKEISYFVAEFIMNNTGEWIRQNGGWENGFVKKFEPKSGWMTFLEV
TGKISILLTRKDTPYCETGLIFLTLMETIANTYFYFKINNFDDVT
>gnl|bcl2dbpro|G1R3W6_BCL2L10-01 BCL2-like 10 protein OS=[Eukaryota] Nomascus leucogenys GN=BCL2L10 (length=231 residues).
MVDQLRERTERLLADYLGCCAREPGTPEPTPSTPEAAMLRSAAARLRQLHPSFFSAYLGYPGNRVELVVLMADSVLSDSP
GPTWGRVVTLVAFAGTLLERGPLVTARWKKWGFQPRLKEQEGDVARDCQRLVALLSSRLVGQHRAWLQAQGGWVSTRRTP
GHGAGRAAGKRPRGRHGWLLSLLQDPLSAGFLEKTAGPGFSVMLVNNSLHLFLDTIIMSFKTFNPLLPAQL
>gnl|bcl2dbpro|G1RER8_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Nomascus leucogenys GN=BCL2L1 (length=217 residues).
MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGTESEMETPSAINGNPSWHLADSPAVNGATGHSSSLDAREV
IPMAAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQ
VLVSRIAAWMATYLNDHLEPWIQENGGWDTFVELYGNNAAAESRKGQERFNRWFLTG
>gnl|bcl2dbpro|G1RYB4_BCL2L2-03 BCL2-like 2 protein OS=[Eukaryota] Nomascus leucogenys GN=BCL2L2 (length=193 residues).
MATPASAPDTRALVADFVGYKLRQKGYVCGAGPGEGPAADPLHQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQRFT
QVSDELFQGGPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQEWMVAYLETRLADWIHSSGGWAEFTALYGDGALEEAR
RLREGNWASVRTVLTGAVALGALVTVGAFFASK
>gnl|bcl2dbpro|G1RYB4_BCL2L2-01 BCL2-like 2 protein OS=[Eukaryota] Nomascus leucogenys GN=BCL2L2 (length=333 residues).
MATPASAPDTRALVADFVGYKLRQKGYVCGAGPGEGPAADPLHQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQRFT
QVSDELFQGGPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQEWMVAYLETRLADWIHSSGGWELEAIKARVREMEEEA
EKLKELQNEVEKQMNMSPPPGNAGPVIMSIEEKMEADARSIYVGNVDYGATAEELEAHFHGCGSVNRVTILCDKFSGHPK
GFAYIEFSDKESVRTSLALDESLFRGRQIKVIPKRTNRPGISTTDRGFPRARYRARTTNYNSSRSRFYSGFNSRPRGRVY
RGRARATSWYSPY
© 1998-2019