Dataset for protein Bcl2l10 of organism Nomascus leucogenys

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|G1R3W6_BCL2L10-01 BCL2-like 10 protein OS=[Eukaryota] Nomascus leucogenys GN=BCL2L10 (length=231 residues).
MVDQLRERTERLLADYLGCCAREPGTPEPTPSTPEAAMLRSAAARLRQLHPSFFSAYLGYPGNRVELVVLMADSVLSDSP
GPTWGRVVTLVAFAGTLLERGPLVTARWKKWGFQPRLKEQEGDVARDCQRLVALLSSRLVGQHRAWLQAQGGWVSTRRTP
GHGAGRAAGKRPRGRHGWLLSLLQDPLSAGFLEKTAGPGFSVMLVNNSLHLFLDTIIMSFKTFNPLLPAQL
© 1998-2019