Dataset for protein Bcl-xL of organism Nomascus leucogenys

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|G1RER8_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Nomascus leucogenys GN=BCL2L1 (length=217 residues).
MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGTESEMETPSAINGNPSWHLADSPAVNGATGHSSSLDAREV
IPMAAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQ
VLVSRIAAWMATYLNDHLEPWIQENGGWDTFVELYGNNAAAESRKGQERFNRWFLTG
© 1998-2019